Lineage for d1f5aa4 (1f5a A:20-214)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338199Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 338200Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) (S)
  5. 338333Family d.218.1.3: Poly(A) polymerase N-terminal, catalytic domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 338334Protein Poly(A) polymerase N-terminal, catalytic domain [81588] (2 species)
  7. 338338Species Cow (Bos taurus) [TaxId:9913] [81587] (1 PDB entry)
  8. 338339Domain d1f5aa4: 1f5a A:20-214 [75836]
    Other proteins in same PDB: d1f5aa1, d1f5aa3
    complexed with 3at, 3po, mn; mutant

Details for d1f5aa4

PDB Entry: 1f5a (more details), 2.5 Å

PDB Description: crystal structure of mammalian poly(a) polymerase

SCOP Domain Sequences for d1f5aa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5aa4 d.218.1.3 (A:20-214) Poly(A) polymerase N-terminal, catalytic domain {Cow (Bos taurus)}
ygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewirei
sesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklkl
qeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldircir
slngcrvtdeilhlv

SCOP Domain Coordinates for d1f5aa4:

Click to download the PDB-style file with coordinates for d1f5aa4.
(The format of our PDB-style files is described here.)

Timeline for d1f5aa4: