![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) ![]() |
![]() | Family d.218.1.3: Poly(A) polymerase N-terminal, catalytic domain [81589] (1 protein) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543 |
![]() | Protein Poly(A) polymerase N-terminal, catalytic domain [81588] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81587] (1 PDB entry) |
![]() | Domain d1f5aa4: 1f5a A:20-214 [75836] Other proteins in same PDB: d1f5aa1, d1f5aa3 complexed with 3at, 3po, mn; mutant |
PDB Entry: 1f5a (more details), 2.5 Å
SCOP Domain Sequences for d1f5aa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5aa4 d.218.1.3 (A:20-214) Poly(A) polymerase N-terminal, catalytic domain {Cow (Bos taurus)} ygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewirei sesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklkl qeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldircir slngcrvtdeilhlv
Timeline for d1f5aa4: