Lineage for d1f5aa3 (1f5a A:215-364)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927039Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 927040Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (5 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 927041Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)
  6. 927042Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)
  7. 927052Species Cow (Bos taurus) [TaxId:9913] [56707] (3 PDB entries)
    Uniprot P25500 18-497
  8. 927054Domain d1f5aa3: 1f5a A:215-364 [75835]
    Other proteins in same PDB: d1f5aa1, d1f5aa4
    complexed with 3at, 3po, mn

Details for d1f5aa3

PDB Entry: 1f5a (more details), 2.5 Å

PDB Description: crystal structure of mammalian poly(a) polymerase
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d1f5aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5aa3 a.160.1.1 (A:215-364) Poly(A) polymerase, PAP, middle domain {Cow (Bos taurus) [TaxId: 9913]}
pnidnfrltlraiklwakrhniysnilgflggvswamlvartcqlypnaiastlvhkffl
vfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvsvstr
mvmveefkqglaitdeillskaewsklfea

SCOPe Domain Coordinates for d1f5aa3:

Click to download the PDB-style file with coordinates for d1f5aa3.
(The format of our PDB-style files is described here.)

Timeline for d1f5aa3: