Lineage for d1ee8b3 (1ee8 B:211-266)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750541Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 750542Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 750567Species Thermus thermophilus [TaxId:274] [81610] (1 PDB entry)
  8. 750569Domain d1ee8b3: 1ee8 B:211-266 [75828]
    Other proteins in same PDB: d1ee8a1, d1ee8a2, d1ee8b1, d1ee8b2
    complexed with zn

Details for d1ee8b3

PDB Entry: 1ee8 (more details), 1.9 Å

PDB Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8
PDB Compounds: (B:) mutm (fpg) protein

SCOP Domain Sequences for d1ee8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee8b3 g.39.1.8 (B:211-266) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]}
dqsyrqpdglpggfqtrhavygreglpcpacgrpverrvvagrgthfcptcqgegp

SCOP Domain Coordinates for d1ee8b3:

Click to download the PDB-style file with coordinates for d1ee8b3.
(The format of our PDB-style files is described here.)

Timeline for d1ee8b3: