SCOP 1.73: Domain d1ee8b1: 1ee8 B:122-210

Lineage for d1ee8b1 (1ee8 B:122-210)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Thermus thermophilus [TaxId:274] [81608] (1 PDB entry)

8. Domain d1ee8b1: 1ee8 B:122-210 [75826]
   Other proteins in same PDB: d1ee8a2, d1ee8a3, d1ee8b2, d1ee8b3
   complexed with zn

Details for d1ee8b1

PDB Entry: 1ee8, 1.9 Å

PDB Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8

PDB Compounds: (B:) mutm (fpg) protein

SCOP Domain Sequences for d1ee8b1:

Sequence; same for both SEQRES and ATOM records:

>d1ee8b1 a.156.1.2 (B:122-210) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]}
gpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpars
lteeearrlyralrevlaeavelggstls

Timeline for d1ee8b1:

• d1ee8b1 first appeared in SCOP 1.63
  
• d1ee8b1 appears in SCOP 1.71
  
• d1ee8b1 appears in SCOP 1.75
  
• d1ee8b1 appears in the current release, SCOPe 2.08