Lineage for d1ee8b1 (1ee8 B:122-210)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545373Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 545374Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 545396Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 545397Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 545419Species Thermus thermophilus [TaxId:274] [81608] (1 PDB entry)
  8. 545421Domain d1ee8b1: 1ee8 B:122-210 [75826]
    Other proteins in same PDB: d1ee8a2, d1ee8a3, d1ee8b2, d1ee8b3
    complexed with zn

Details for d1ee8b1

PDB Entry: 1ee8 (more details), 1.9 Å

PDB Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8

SCOP Domain Sequences for d1ee8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee8b1 a.156.1.2 (B:122-210) DNA repair protein MutM (Fpg) {Thermus thermophilus}
gpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpars
lteeearrlyralrevlaeavelggstls

SCOP Domain Coordinates for d1ee8b1:

Click to download the PDB-style file with coordinates for d1ee8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ee8b1: