Class a: All alpha proteins [46456] (218 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Thermus thermophilus [TaxId:274] [81608] (1 PDB entry) |
Domain d1ee8b1: 1ee8 B:122-210 [75826] Other proteins in same PDB: d1ee8a2, d1ee8a3, d1ee8b2, d1ee8b3 |
PDB Entry: 1ee8 (more details), 1.9 Å
SCOP Domain Sequences for d1ee8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee8b1 a.156.1.2 (B:122-210) DNA repair protein MutM (Fpg) {Thermus thermophilus} gpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpars lteeearrlyralrevlaeavelggstls
Timeline for d1ee8b1: