SCOP 1.73: Domain d1ee8a2: 1ee8 A:1-121

Lineage for d1ee8a2 (1ee8 A:1-121)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)

6. Protein DNA repair protein MutM (Fpg) [81621] (4 species)

7. Species Thermus thermophilus [TaxId:274] [81609] (1 PDB entry)

8. Domain d1ee8a2: 1ee8 A:1-121 [75824]
   Other proteins in same PDB: d1ee8a1, d1ee8a3, d1ee8b1, d1ee8b3

Details for d1ee8a2

PDB Entry: 1ee8, 1.9 Å

PDB Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8

PDB Compounds: (A:) mutm (fpg) protein

SCOP Domain Sequences for d1ee8a2:

Sequence; same for both SEQRES and ATOM records:

>d1ee8a2 b.113.1.1 (A:1-121) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]}
pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg
gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr
l

Timeline for d1ee8a2:

• d1ee8a2 first appeared in SCOP 1.63
  
• d1ee8a2 appears in SCOP 1.71
  
• d1ee8a2 appears in SCOP 1.75
  
• d1ee8a2 appears in the current release, SCOPe 2.08