![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) ![]() |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81609] (1 PDB entry) |
![]() | Domain d1ee8a2: 1ee8 A:1-121 [75824] Other proteins in same PDB: d1ee8a1, d1ee8a3, d1ee8b1, d1ee8b3 |
PDB Entry: 1ee8 (more details), 1.9 Å
SCOP Domain Sequences for d1ee8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee8a2 b.113.1.1 (A:1-121) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]} pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr l
Timeline for d1ee8a2: