![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (2 proteins) contains 4 helices in the core |
![]() | Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81608] (1 PDB entry) |
![]() | Domain d1ee8a1: 1ee8 A:122-210 [75823] Other proteins in same PDB: d1ee8a2, d1ee8a3, d1ee8b2, d1ee8b3 |
PDB Entry: 1ee8 (more details), 1.9 Å
SCOP Domain Sequences for d1ee8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ee8a1 a.156.1.2 (A:122-210) DNA repair protein MutM (Fpg) {Thermus thermophilus} gpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpars lteeearrlyralrevlaeavelggstls
Timeline for d1ee8a1: