Lineage for d1bpya4 (1bpy A:149-335)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944794Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1944795Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1944803Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1944804Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 1944805Species Human (Homo sapiens) [TaxId:9606] [81574] (144 PDB entries)
    Uniprot P06746
  8. 1944850Domain d1bpya4: 1bpy A:149-335 [75820]
    Other proteins in same PDB: d1bpya1, d1bpya3
    protein/DNA complex; complexed with dct, mg, na

Details for d1bpya4

PDB Entry: 1bpy (more details), 2.2 Å

PDB Description: human dna polymerase beta complexed with gapped dna and ddctp
PDB Compounds: (A:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d1bpya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpya4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d1bpya4:

Click to download the PDB-style file with coordinates for d1bpya4.
(The format of our PDB-style files is described here.)

Timeline for d1bpya4: