Lineage for d1bpe_3 (1bpe 92-148)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539721Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 539722Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 539723Protein DNA polymerase beta [81579] (2 species)
  7. 539819Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)
  8. 539839Domain d1bpe_3: 1bpe 92-148 [75815]
    Other proteins in same PDB: d1bpe_1, d1bpe_4
    complexed with dtp

Details for d1bpe_3

PDB Entry: 1bpe (more details), 3.9 Å

PDB Description: crystal structure of rat dna polymerase beta; evidence for a common polymerase mechanism

SCOP Domain Sequences for d1bpe_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpe_3 a.60.12.1 (92-148) DNA polymerase beta {Rat (Rattus norvegicus)}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOP Domain Coordinates for d1bpe_3:

Click to download the PDB-style file with coordinates for d1bpe_3.
(The format of our PDB-style files is described here.)

Timeline for d1bpe_3: