Class a: All alpha proteins [46456] (171 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins) topological similarity to the N-terminal domain |
Protein DNA polymerase beta [81579] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries) |
Domain d1bpe_3: 1bpe 92-148 [75815] Other proteins in same PDB: d1bpe_1, d1bpe_4 complexed with dtp |
PDB Entry: 1bpe (more details), 3.9 Å
SCOP Domain Sequences for d1bpe_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bpe_3 a.60.12.1 (92-148) DNA polymerase beta {Rat (Rattus norvegicus)} dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek
Timeline for d1bpe_3: