Lineage for d1bgyo3 (1bgy O:1-260)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253332Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2253333Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2253339Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2253350Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 2253372Species Cow (Bos taurus) [TaxId:9913] [81638] (18 PDB entries)
    Uniprot P00157
  8. 2253393Domain d1bgyo3: 1bgy O:1-260 [75810]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyi_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyu_, d1bgyv_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgyo3

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (O:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyo3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyo3 f.21.1.2 (O:1-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
llvlfapdllgdpdnytpan

SCOPe Domain Coordinates for d1bgyo3:

Click to download the PDB-style file with coordinates for d1bgyo3.
(The format of our PDB-style files is described here.)

Timeline for d1bgyo3: