SCOP 1.67: Domain d1be3c2: 1be3 C:261-379

Lineage for d1be3c2 (1be3 C:261-379)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81643] (9 PDB entries)

8. Domain d1be3c2: 1be3 C:261-379 [75805]
   Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_
   complexed with fes, hec, hem

Details for d1be3c2

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3c2:

Sequence; same for both SEQRES and ATOM records:

>d1be3c2 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus)}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d1be3c2:

• d1be3c2 first appeared in SCOP 1.63
  
• d1be3c2 appears in SCOP 1.65
  
• d1be3c2 appears in SCOP 1.69
  
• d1be3c2 appears in the current release, SCOPe 2.08