![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries) |
![]() | Domain d1bccc3: 1bcc C:2-261 [75804] Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc2, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_ complexed with bog, fes, hem, pee, u10 |
PDB Entry: 1bcc (more details), 3.16 Å
SCOPe Domain Sequences for d1bccc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bccc3 f.21.1.2 (C:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl tlalfspnllgdpenftpan
Timeline for d1bccc3: