Lineage for d1bccc2 (1bcc C:262-380)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426851Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 426852Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 426853Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 426854Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 426861Species Chicken (Gallus gallus) [TaxId:9031] [81644] (3 PDB entries)
  8. 426862Domain d1bccc2: 1bcc C:262-380 [75803]
    Other proteins in same PDB: d1bcca1, d1bcca2, d1bccb1, d1bccb2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
    complexed with bog, fes, hem, pee, u10

Details for d1bccc2

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken

SCOP Domain Sequences for d1bccc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bccc2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus)}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOP Domain Coordinates for d1bccc2:

Click to download the PDB-style file with coordinates for d1bccc2.
(The format of our PDB-style files is described here.)

Timeline for d1bccc2: