Lineage for d1a6qa2 (1a6q A:2-296)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007405Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 3007406Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 3007407Family d.219.1.1: PP2C-like [81605] (3 proteins)
    Pfam PF00481
  6. 3007408Protein Protein serine/threonine phosphatase 2C, catalytic domain [81604] (1 species)
  7. 3007409Species Human (Homo sapiens) [TaxId:9606] [81603] (1 PDB entry)
  8. 3007410Domain d1a6qa2: 1a6q A:2-296 [75802]
    Other proteins in same PDB: d1a6qa1
    complexed with mn, po4

Details for d1a6qa2

PDB Entry: 1a6q (more details), 2 Å

PDB Description: crystal structure of the protein serine/threonine phosphatase 2c at 2 a resolution
PDB Compounds: (A:) phosphatase 2c

SCOPe Domain Sequences for d1a6qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6qa2 d.219.1.1 (A:2-296) Protein serine/threonine phosphatase 2C, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg
hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapk

SCOPe Domain Coordinates for d1a6qa2:

Click to download the PDB-style file with coordinates for d1a6qa2.
(The format of our PDB-style files is described here.)

Timeline for d1a6qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6qa1