Lineage for d1a6qa1 (1a6q A:297-368)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013855Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2013856Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (2 families) (S)
    automatically mapped to Pfam PF07830
  5. 2013857Family a.159.1.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81600] (1 protein)
  6. 2013858Protein Protein serine/threonine phosphatase 2C, C-terminal domain [81599] (1 species)
  7. 2013859Species Human (Homo sapiens) [TaxId:9606] [81598] (1 PDB entry)
  8. 2013860Domain d1a6qa1: 1a6q A:297-368 [75801]
    Other proteins in same PDB: d1a6qa2
    complexed with mn, po4

Details for d1a6qa1

PDB Entry: 1a6q (more details), 2 Å

PDB Description: crystal structure of the protein serine/threonine phosphatase 2c at 2 a resolution
PDB Compounds: (A:) phosphatase 2c

SCOPe Domain Sequences for d1a6qa1:

Sequence, based on SEQRES records: (download)

>d1a6qa1 a.159.1.1 (A:297-368) Protein serine/threonine phosphatase 2C, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records): (download)

>d1a6qa1 a.159.1.1 (A:297-368) Protein serine/threonine phosphatase 2C, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnviea
vynrlnpy

SCOPe Domain Coordinates for d1a6qa1:

Click to download the PDB-style file with coordinates for d1a6qa1.
(The format of our PDB-style files is described here.)

Timeline for d1a6qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a6qa2