Lineage for d1qb4a_ (1qb4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088185Family c.1.12.3: Phosphoenolpyruvate carboxylase [51632] (1 protein)
    automatically mapped to Pfam PF00311
  6. 2088186Protein Phosphoenolpyruvate carboxylase [51633] (1 species)
    the common fold is decorated with many additional helices
  7. 2088187Species Escherichia coli [TaxId:562] [51634] (4 PDB entries)
  8. 2088189Domain d1qb4a_: 1qb4 A: [74640]
    complexed with asp, mn

Details for d1qb4a_

PDB Entry: 1qb4 (more details), 2.6 Å

PDB Description: crystal structure of mn(2+)-bound phosphoenolpyruvate carboxylase
PDB Compounds: (A:) phosphoenolpyruvate carboxylase

SCOPe Domain Sequences for d1qb4a_:

Sequence, based on SEQRES records: (download)

>d1qb4a_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]}
qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakrrptggveslraipwifawtq
nrlmlpawlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyyd
qrlvdkalwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlq
aellhrsrqaekegqepdprveqalmvtiagiaagmrntg

Sequence, based on observed residues (ATOM records): (download)

>d1qb4a_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]}
qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakveslraipwifawtqnrlmlp
awlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyydqrlvdk
alwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlqaellhr
srqaekegqepdprveqalmvtiagiaagmrntg

SCOPe Domain Coordinates for d1qb4a_:

Click to download the PDB-style file with coordinates for d1qb4a_.
(The format of our PDB-style files is described here.)

Timeline for d1qb4a_: