Lineage for d1md4a2 (1md4 A:2-76)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584951Protein Class pi GST [81358] (4 species)
  7. 584952Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)
  8. 584996Domain d1md4a2: 1md4 A:2-76 [74633]
    Other proteins in same PDB: d1md4a1, d1md4b1

Details for d1md4a2

PDB Entry: 1md4 (more details), 2.1 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to valine

SCOP Domain Sequences for d1md4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1md4a2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens)}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d1md4a2:

Click to download the PDB-style file with coordinates for d1md4a2.
(The format of our PDB-style files is described here.)

Timeline for d1md4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1md4a1