| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
| Protein Class pi GST [81347] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries) |
| Domain d1md3b1: 1md3 B:77-209 [74630] Other proteins in same PDB: d1md3a2, d1md3b2 |
PDB Entry: 1md3 (more details), 2.03 Å
SCOP Domain Sequences for d1md3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1md3b1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivadqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq
Timeline for d1md3b1: