SCOP 1.73: Domain d1md3a1: 1md3 A:77-209

Lineage for d1md3a1 (1md3 A:77-209)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (39 PDB entries)

8. Domain d1md3a1: 1md3 A:77-209 [74628]
   Other proteins in same PDB: d1md3a2, d1md3b2

Details for d1md3a1

PDB Entry: 1md3, 2.03 Å

PDB Description: a folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to alanine

PDB Compounds: (A:) pi glutathione transferase

SCOP Domain Sequences for d1md3a1:

Sequence; same for both SEQRES and ATOM records:

>d1md3a1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivadqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d1md3a1:

• d1md3a1 first appeared in SCOP 1.61
  
• d1md3a1 appears in SCOP 1.71
  
• d1md3a1 appears in SCOP 1.75
  
• d1md3a1 appears in the current release, SCOPe 2.08