Lineage for d1mc2a_ (1mc2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346166Species Hundred-pace snake (Agkistrodon acutus) [TaxId:36307] [74796] (2 PDB entries)
    monomeric Lys-49 phospholipase A2 homologue
  8. 2346167Domain d1mc2a_: 1mc2 A: [74622]
    complexed with ipa

Details for d1mc2a_

PDB Entry: 1mc2 (more details), 0.85 Å

PDB Description: monomeric lys-49 phospholipase a2 homologue purified from ag
PDB Compounds: (A:) Acutohaemonlysin

SCOPe Domain Sequences for d1mc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]}
slfelgkmiwqetgknpvknyglygcncgvggrgepldatdrccfvhkccykkltdcdsk
kdrysykwknkaivcgknqpcmqemcecdkafaiclrenldtynksfryhlkpsckktse
qc

SCOPe Domain Coordinates for d1mc2a_:

Click to download the PDB-style file with coordinates for d1mc2a_.
(The format of our PDB-style files is described here.)

Timeline for d1mc2a_: