Lineage for d1ma1e2 (1ma1 E:92-204)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411455Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1411483Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 1411505Species Methanobacterium thermoautotrophicum [TaxId:145262] [75410] (1 PDB entry)
  8. 1411510Domain d1ma1e2: 1ma1 E:92-204 [74618]
    Other proteins in same PDB: d1ma1a1, d1ma1b1, d1ma1c1, d1ma1d1, d1ma1e1, d1ma1f1
    complexed with fe

Details for d1ma1e2

PDB Entry: 1ma1 (more details), 2.6 Å

PDB Description: Structure and properties of the atypical iron superoxide dismutase from Methanobacterium thermoautotrophicum
PDB Compounds: (E:) superoxide dismutase

SCOPe Domain Sequences for d1ma1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ma1e2 d.44.1.1 (E:92-204) Fe superoxide dismutase (FeSOD) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
ecggepsgklaeyiekdfgsferfrkefsqaaisaegsgwavltycqrtdrlfimqvekh
nvnviphfrillvldvwehayyidyrnvrpdyveafwnivnwkevekrfedil

SCOPe Domain Coordinates for d1ma1e2:

Click to download the PDB-style file with coordinates for d1ma1e2.
(The format of our PDB-style files is described here.)

Timeline for d1ma1e2: