Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [75410] (1 PDB entry) |
Domain d1ma1b2: 1ma1 B:92-204 [74612] Other proteins in same PDB: d1ma1a1, d1ma1b1, d1ma1c1, d1ma1d1, d1ma1e1, d1ma1f1 complexed with fe |
PDB Entry: 1ma1 (more details), 2.6 Å
SCOPe Domain Sequences for d1ma1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ma1b2 d.44.1.1 (B:92-204) Fe superoxide dismutase (FeSOD) {Methanobacterium thermoautotrophicum [TaxId: 145262]} ecggepsgklaeyiekdfgsferfrkefsqaaisaegsgwavltycqrtdrlfimqvekh nvnviphfrillvldvwehayyidyrnvrpdyveafwnivnwkevekrfedil
Timeline for d1ma1b2: