Lineage for d1ma0a2 (1ma0 A:175-324)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175019Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 175020Protein Alcohol dehydrogenase [51737] (4 species)
  7. 175079Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (16 PDB entries)
  8. 175090Domain d1ma0a2: 1ma0 A:175-324 [74606]
    Other proteins in same PDB: d1ma0a1, d1ma0b1

Details for d1ma0a2

PDB Entry: 1ma0 (more details), 2.3 Å

PDB Description: Ternary complex of Human glutathione-dependent formaldehyde dehydrogenase with NAD+ and dodecanoic acid

SCOP Domain Sequences for d1ma0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ma0a2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
istgygaavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakef
gatecinpqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgva
asgeeiatrpfqlvtgrtwkgtafggwksv

SCOP Domain Coordinates for d1ma0a2:

Click to download the PDB-style file with coordinates for d1ma0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ma0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ma0a1