SCOPe 2.08: Domain d1m9wa_: 1m9w A:

Lineage for d1m9wa_ (1m9w A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [49519] (6 PDB entries)

8. Domain d1m9wa_: 1m9w A: [74604]

Details for d1m9wa_

PDB Entry: 1m9w

PDB Description: study of electrostatic potential surface distribution using high resolution side-chain conformation determined by nmr

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1m9wa_:

Sequence; same for both SEQRES and ATOM records:

>d1m9wa_ b.6.1.1 (A:) Plastocyanin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
lafaagesftstftepgtytyycephrgagmvgkvvve

Timeline for d1m9wa_:

• d1m9wa_ first appeared in SCOP 1.61
  
• d1m9wa_ appears in SCOPe 2.07