SCOP 1.73: Domain d1m9uc_: 1m9u C:

Lineage for d1m9uc_ (1m9u C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Worm (Eisenia fetida) [TaxId:6396] [74973] (1 PDB entry)
   fibrinolytic enzyme component A

8. Domain d1m9uc_: 1m9u C: [74603]

Details for d1m9uc_

PDB Entry: 1m9u, 2.3 Å

PDB Description: Crystal Structure of Earthworm Fibrinolytic Enzyme Component A from Eisenia fetida

PDB Compounds: (C:) Earthworm Fibrinolytic Enzyme

SCOP Domain Sequences for d1m9uc_:

Sequence; same for both SEQRES and ATOM records:

>d1m9uc_ b.47.1.2 (C:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]}
viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
s

Timeline for d1m9uc_:

• d1m9uc_ first appeared in SCOP 1.61
  
• d1m9uc_ appears in SCOP 1.71
  
• d1m9uc_ appears in SCOP 1.75
  
• d1m9uc_ appears in the current release, SCOPe 2.08