Lineage for d1m9uc_ (1m9u C:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) 
Protein Elastase [50536] (4 species) 
Species Earthworm (Eisenia fetida) [74973] (1 PDB entry) 
Domain d1m9uc_: 1m9u C: [74603]
Details for d1m9uc_
PDB Entry: 1m9u (more details), 2.3 Å
PDB Description: Crystal Structure of Earthworm Fibrinolytic Enzyme Component A from Eisenia fetida
SCOP Domain Sequences for d1m9uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9uc_ b.47.1.2 (C:) Elastase {Earthworm (Eisenia fetida)}
viggtnaspgefpwqlsqqrqsgswshscgasllsstsalsashcvdgvlpnnirviagl
wqqsdtsgtqtanvdsytmhenygagtasysndiailhlatsislggniqaavlpannnn
dyagttcvisgwgrtdgtnnlpdilqkssipvittaqctaamvgvgganiwdnhicvqdp
agntgacngdsggplncpdggtrvvgvtswvvssglgaclpdypsvytrvsaylgwigdn
s
SCOP Domain Coordinates for d1m9uc_:
Click to download the PDB-style file with coordinates for d1m9uc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m9uc_:
- d1m9uc_ is new in SCOP 1.61
- d1m9uc_ appears in SCOP 1.63
- d1m9uc_ appears in the current release, SCOPe 2.08
View in 3D
