Lineage for d1m8db_ (1m8d B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878765Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 878766Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 878767Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 878768Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 878885Species Mouse (Mus musculus) [TaxId:10090] [56515] (38 PDB entries)
    Uniprot P29477 77-496
    Uniprot P29477 77-495
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 878899Domain d1m8db_: 1m8d B: [74582]
    complexed with bog, clw, egl, h4b, hem, so4

Details for d1m8db_

PDB Entry: 1m8d (more details), 2.35 Å

PDB Description: inducible nitric oxide synthase with chlorzoxazone bound
PDB Compounds: (B:) inducible nitric oxide synthase

SCOP Domain Sequences for d1m8db_:

Sequence, based on SEQRES records: (download)

>d1m8db_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Sequence, based on observed residues (ATOM records): (download)

>d1m8db_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsclgsimnpksltrgprdkptpleellphaiefinqy
ygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlq
vfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagy
qmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevt
mehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryn
ileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqne
yrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn

SCOP Domain Coordinates for d1m8db_:

Click to download the PDB-style file with coordinates for d1m8db_.
(The format of our PDB-style files is described here.)

Timeline for d1m8db_: