Lineage for d1m8da_ (1m8d A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049000Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1049001Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 1049002Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1049003Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1049124Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1049148Domain d1m8da_: 1m8d A: [74581]
    complexed with bog, clw, edo, h4b, hem, so4

Details for d1m8da_

PDB Entry: 1m8d (more details), 2.35 Å

PDB Description: inducible nitric oxide synthase with chlorzoxazone bound
PDB Compounds: (A:) inducible nitric oxide synthase

SCOPe Domain Sequences for d1m8da_:

Sequence, based on SEQRES records: (download)

>d1m8da_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Sequence, based on observed residues (ATOM records): (download)

>d1m8da_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
qyvriknwgsgeilhdtlhhkatsdksclgsimnpksltrgprdkptpleellphaiefi
nqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqws
nlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliry
agyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvl
evtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtq
rynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhm
qneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn

SCOPe Domain Coordinates for d1m8da_:

Click to download the PDB-style file with coordinates for d1m8da_.
(The format of our PDB-style files is described here.)

Timeline for d1m8da_: