Lineage for d1m8da_ (1m8d A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199123Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
  4. 199124Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 199125Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 199126Protein Nitric oxide (NO) synthase oxygenase domain [56514] (3 species)
  7. 199213Species Mouse (Mus musculus) [TaxId:10090] [56515] (18 PDB entries)
  8. 199219Domain d1m8da_: 1m8d A: [74581]

Details for d1m8da_

PDB Entry: 1m8d (more details), 2.35 Å

PDB Description: inducible nitric oxide synthase with chlorzoxazone bound

SCOP Domain Sequences for d1m8da_:

Sequence, based on SEQRES records: (download)

>d1m8da_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus)}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
n

Sequence, based on observed residues (ATOM records): (download)

>d1m8da_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus)}
qyvriknwgsgeilhdtlhhkatsdksclgsimnpksltrgprdkptpleellphaiefi
nqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqws
nlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliry
agyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvl
evtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtq
rynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhm
qneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwqn

SCOP Domain Coordinates for d1m8da_:

Click to download the PDB-style file with coordinates for d1m8da_.
(The format of our PDB-style files is described here.)

Timeline for d1m8da_: