![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (23 proteins) |
![]() | Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
![]() | Species Human (Homo sapiens), ccl20/mip-3a [TaxId:9606] [75340] (1 PDB entry) |
![]() | Domain d1m8ab_: 1m8a B: [74580] complexed with ioh |
PDB Entry: 1m8a (more details), 1.7 Å
SCOP Domain Sequences for d1m8ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8ab_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), ccl20/mip-3a} dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrlls k
Timeline for d1m8ab_: