Lineage for d1m85a_ (1m85 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015076Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 3015077Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 3015078Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 3015079Protein Catalase I [56636] (8 species)
  7. 3015150Species Proteus mirabilis [TaxId:584] [56640] (11 PDB entries)
  8. 3015152Domain d1m85a_: 1m85 A: [74578]
    complexed with gol, hem, so4

Details for d1m85a_

PDB Entry: 1m85 (more details), 2 Å

PDB Description: Structure of Proteus mirabilis catalase for the native form
PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d1m85a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m85a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]}
kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle

SCOPe Domain Coordinates for d1m85a_:

Click to download the PDB-style file with coordinates for d1m85a_.
(The format of our PDB-style files is described here.)

Timeline for d1m85a_: