Lineage for d1m7ba_ (1m7b A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846837Protein RhoE (RND3) [75201] (1 species)
  7. 1846838Species Mouse (Mus musculus) [TaxId:10090] [75202] (2 PDB entries)
  8. 1846839Domain d1m7ba_: 1m7b A: [74572]
    complexed with gtp, mg

Details for d1m7ba_

PDB Entry: 1m7b (more details), 2 Å

PDB Description: Crystal structure of Rnd3/RhoE: functional implications
PDB Compounds: (A:) Rnd3/RhoE small GTP-binding protein

SCOPe Domain Sequences for d1m7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}
vkckivvvgdsqcgktallhvfakdcfpenyvptvfenytasfeidtqrielslwdtsgs
pyydnvrplsypdsdavlicfdisrpetldsvlkkwkgeiqefcpntkmllvgcksdlrt
dvstlvelsnhrqtpvsydqganmakqigaatyiecsalqsensvrdifhvatlacvnk

SCOPe Domain Coordinates for d1m7ba_:

Click to download the PDB-style file with coordinates for d1m7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ba_: