Lineage for d1m6vh2 (1m6v H:153-380)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241731Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures
  5. 241732Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (5 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 241743Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 241744Species Escherichia coli [TaxId:562] [52322] (9 PDB entries)
  8. 241780Domain d1m6vh2: 1m6v H:153-380 [74567]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb1, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1
    complexed with adp, cl, k, mn, net, orn, pi; mutant

Details for d1m6vh2

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase

SCOP Domain Sequences for d1m6vh2:

Sequence, based on SEQRES records: (download)

>d1m6vh2 c.23.16.1 (H:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspfphdaaplfdhfielieqyrkt

Sequence, based on observed residues (ATOM records): (download)

>d1m6vh2 c.23.16.1 (H:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1m6vh2:

Click to download the PDB-style file with coordinates for d1m6vh2.
(The format of our PDB-style files is described here.)

Timeline for d1m6vh2: