Lineage for d1m6vg2 (1m6v G:936-1073)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482161Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 482162Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 482163Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 482164Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 482165Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
  8. 482185Domain d1m6vg2: 1m6v G:936-1073 [74561]
    Other proteins in same PDB: d1m6va1, d1m6va3, d1m6va4, d1m6va5, d1m6va6, d1m6vb1, d1m6vb2, d1m6vc1, d1m6vc3, d1m6vc4, d1m6vc5, d1m6vc6, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve3, d1m6ve4, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg3, d1m6vg4, d1m6vg5, d1m6vg6, d1m6vh1, d1m6vh2

Details for d1m6vg2

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase

SCOP Domain Sequences for d1m6vg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6vg2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1m6vg2:

Click to download the PDB-style file with coordinates for d1m6vg2.
(The format of our PDB-style files is described here.)

Timeline for d1m6vg2: