Details for d1m6vg1

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase
PDB Compounds: (G:)

SCOP Domain Sequences for d1m6vg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6vg1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1m6vg1:

Click to download the PDB-style file with coordinates for d1m6vg1.
(The format of our PDB-style files is described here.)

Timeline for d1m6vg1: