Lineage for d1m6ve3 (1m6v E:1-127)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178746Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 178747Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 178748Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 178757Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)
  7. 178758Species Escherichia coli [TaxId:562] [52451] (9 PDB entries)
  8. 178827Domain d1m6ve3: 1m6v E:1-127 [74554]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va5, d1m6va6, d1m6vb1, d1m6vb2, d1m6vc1, d1m6vc2, d1m6vc5, d1m6vc6, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve2, d1m6ve5, d1m6ve6, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg2, d1m6vg5, d1m6vg6, d1m6vh1, d1m6vh2

Details for d1m6ve3

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase

SCOP Domain Sequences for d1m6ve3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ve3 c.30.1.1 (E:1-127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

SCOP Domain Coordinates for d1m6ve3:

Click to download the PDB-style file with coordinates for d1m6ve3.
(The format of our PDB-style files is described here.)

Timeline for d1m6ve3: