Lineage for d1m6va6 (1m6v A:677-935)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196989Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 196990Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 197010Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 197019Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 197020Species Escherichia coli [TaxId:562] [56077] (9 PDB entries)
  8. 197086Domain d1m6va6: 1m6v A:677-935 [74541]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6vb1, d1m6vb2, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vh1, d1m6vh2

Details for d1m6va6

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: Crystal Structure of the G359F (small subunit) Point Mutant of Carbamoyl Phosphate Synthetase

SCOP Domain Sequences for d1m6va6:

Sequence, based on SEQRES records: (download)

>d1m6va6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr
yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl
paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska
tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge
vmgvgrtfaeafakaqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1m6va6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsameivydeadlrryfqtav
lldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmr
qqvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvma
gkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafak
aqlgs

SCOP Domain Coordinates for d1m6va6:

Click to download the PDB-style file with coordinates for d1m6va6.
(The format of our PDB-style files is described here.)

Timeline for d1m6va6: