Lineage for d1m6va5 (1m6v A:128-402)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334707Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 334708Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 334728Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins)
  6. 334737Protein Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains [56076] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 334738Species Escherichia coli [TaxId:562] [56077] (9 PDB entries)
  8. 334803Domain d1m6va5: 1m6v A:128-402 [74540]
    Other proteins in same PDB: d1m6va1, d1m6va2, d1m6va3, d1m6va4, d1m6vb1, d1m6vb2, d1m6vc1, d1m6vc2, d1m6vc3, d1m6vc4, d1m6vd1, d1m6vd2, d1m6ve1, d1m6ve2, d1m6ve3, d1m6ve4, d1m6vf1, d1m6vf2, d1m6vg1, d1m6vg2, d1m6vg3, d1m6vg4, d1m6vh1, d1m6vh2

Details for d1m6va5

PDB Entry: 1m6v (more details), 2.1 Å

PDB Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase

SCOP Domain Sequences for d1m6va5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6va5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli}
drrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsgggiaynree
feeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdamgihtgds
itvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviemnprvsrs
salaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkiprfnfekf
agandrlttqmksvgevmaigrtqqeslqkalrgl

SCOP Domain Coordinates for d1m6va5:

Click to download the PDB-style file with coordinates for d1m6va5.
(The format of our PDB-style files is described here.)

Timeline for d1m6va5: