Lineage for d1m6ia3 (1m6i A:478-608)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962838Protein Apoptosis-inducing factor (AIF) [75489] (2 species)
    contains a large loop insertion in this domain
  7. 2962839Species Human (Homo sapiens) [TaxId:9606] [75490] (2 PDB entries)
  8. 2962840Domain d1m6ia3: 1m6i A:478-608 [74535]
    Other proteins in same PDB: d1m6ia1, d1m6ia2
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d1m6ia3

PDB Entry: 1m6i (more details), 1.8 Å

PDB Description: Crystal Structure of Apoptosis Inducing Factor (AIF)
PDB Compounds: (A:) Programmed cell death protein 8

SCOPe Domain Sequences for d1m6ia3:

Sequence, based on SEQRES records: (download)

>d1m6ia3 d.87.1.1 (A:478-608) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}
hqsmfwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirsesetese
aseitippstpavpqapvqgedygkgvifylrdkvvvgivlwnifnrmpiarkiikdgeq
hedlnevaklf

Sequence, based on observed residues (ATOM records): (download)

>d1m6ia3 d.87.1.1 (A:478-608) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}
hqsmfwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirsesetese
asygkgvifylrdkvvvgivlwnifnrmpiarkiikdgeqhedlnevaklf

SCOPe Domain Coordinates for d1m6ia3:

Click to download the PDB-style file with coordinates for d1m6ia3.
(The format of our PDB-style files is described here.)

Timeline for d1m6ia3: