Lineage for d1m6ia2 (1m6i A:264-400)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576622Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 576630Protein Apoptosis-inducing factor (AIF) [75126] (2 species)
  7. 576631Species Human (Homo sapiens) [TaxId:9606] [75127] (1 PDB entry)
  8. 576633Domain d1m6ia2: 1m6i A:264-400 [74534]
    Other proteins in same PDB: d1m6ia3
    complexed with fad

Details for d1m6ia2

PDB Entry: 1m6i (more details), 1.8 Å

PDB Description: Crystal Structure of Apoptosis Inducing Factor (AIF)

SCOP Domain Sequences for d1m6ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens)}
prslsaidragaevksrttlfrkigdfrslekisrevksitiigggflgselacalgrka
ralgteviqlfpekgnmgkilpeylsnwtmekvrregvkvmpnaivqsvgvssgkllikl
kdgrkvetdhivaavgl

SCOP Domain Coordinates for d1m6ia2:

Click to download the PDB-style file with coordinates for d1m6ia2.
(The format of our PDB-style files is described here.)

Timeline for d1m6ia2: