Lineage for d1m6ia1 (1m6i A:128-263,A:401-477)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176396Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
  6. 176404Protein Apoptosis-inducing factor (AIF) [75126] (2 species)
  7. 176405Species Human (Homo sapiens) [TaxId:9606] [75127] (1 PDB entry)
  8. 176406Domain d1m6ia1: 1m6i A:128-263,A:401-477 [74533]
    Other proteins in same PDB: d1m6ia3

Details for d1m6ia1

PDB Entry: 1m6i (more details), 1.8 Å

PDB Description: Crystal Structure of Apoptosis Inducing Factor (AIF)

SCOP Domain Sequences for d1m6ia1:

Sequence, based on SEQRES records: (download)

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens)}
apshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfsddpnv
tktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvklnd
gsqityekcliatggtXepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfy
diklgrrrvehhdhavvsgrlagenmtgaakpyw

Sequence, based on observed residues (ATOM records): (download)

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens)}
apshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfspnvtk
tlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvklndgs
qityekcliatggtXepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfydi
klgrrrvehhdhavvsgrlagenmtgaakpyw

SCOP Domain Coordinates for d1m6ia1:

Click to download the PDB-style file with coordinates for d1m6ia1.
(The format of our PDB-style files is described here.)

Timeline for d1m6ia1: