Lineage for d1m6ia1 (1m6i A:128-263,A:401-477)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849893Protein Apoptosis-inducing factor (AIF), N- and C-terminal domain [418936] (2 species)
  7. 2849894Species Human (Homo sapiens) [TaxId:9606] [419374] (2 PDB entries)
  8. 2849895Domain d1m6ia1: 1m6i A:128-263,A:401-477 [74533]
    Other proteins in same PDB: d1m6ia2, d1m6ia3
    complexed with fad
    has additional insertions and/or extensions that are not grouped together

Details for d1m6ia1

PDB Entry: 1m6i (more details), 1.8 Å

PDB Description: Crystal Structure of Apoptosis Inducing Factor (AIF)
PDB Compounds: (A:) Programmed cell death protein 8

SCOPe Domain Sequences for d1m6ia1:

Sequence, based on SEQRES records: (download)

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF), N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfsddpnv
tktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvklnd
gsqityekcliatggtXepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfy
diklgrrrvehhdhavvsgrlagenmtgaakpyw

Sequence, based on observed residues (ATOM records): (download)

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF), N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
apshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwfspnvtk
tlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrdnmvklndgs
qityekcliatggtXepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfydi
klgrrrvehhdhavvsgrlagenmtgaakpyw

SCOPe Domain Coordinates for d1m6ia1:

Click to download the PDB-style file with coordinates for d1m6ia1.
(The format of our PDB-style files is described here.)

Timeline for d1m6ia1: