Lineage for d1m6hb1 (1m6h B:1-174,B:325-373)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227997Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 227998Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 228048Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (6 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 228049Protein Alcohol dehydrogenase [50137] (5 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 228120Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (17 PDB entries)
  8. 228124Domain d1m6hb1: 1m6h B:1-174,B:325-373 [74531]
    Other proteins in same PDB: d1m6ha2, d1m6hb2
    glutathione-dependent formaldehyde dehydrogenase
    complexed with k, po4, zn

Details for d1m6hb1

PDB Entry: 1m6h (more details), 2 Å

PDB Description: Human glutathione-dependent formaldehyde dehydrogenase

SCOP Domain Sequences for d1m6hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6hb1 b.35.1.2 (B:1-174,B:325-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgXesvpk
lvseymskkikvdefvthnlsfdeinkafelmhsgksirtvvki

SCOP Domain Coordinates for d1m6hb1:

Click to download the PDB-style file with coordinates for d1m6hb1.
(The format of our PDB-style files is described here.)

Timeline for d1m6hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m6hb2