Lineage for d1m6bb3 (1m6b B:166-310)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459803Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 1459804Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1459854Protein Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains [75668] (1 species)
  7. 1459855Species Human (Homo sapiens) [TaxId:9606] [75669] (1 PDB entry)
  8. 1459858Domain d1m6bb3: 1m6b B:166-310 [74527]
    Other proteins in same PDB: d1m6ba1, d1m6ba2, d1m6bb1, d1m6bb2
    complexed with nag, ndg, so4

Details for d1m6bb3

PDB Entry: 1m6b (more details), 2.6 Å

PDB Description: Structure of the HER3 (ERBB3) Extracellular Domain
PDB Compounds: (B:) Receptor protein-tyrosine kinase erbB-3

SCOPe Domain Sequences for d1m6bb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6bb3 g.3.9.1 (B:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
pchevckgrcwgpgsedcqtltkticapqcnghcfgpnpnqcchdecaggcsgpqdtdcf
acrhfndsgacvprcpqplvynkltfqlepnphtkyqyggvcvascphnfvvdqtscvra
cppdkmevdknglkmcepcgglcpk

SCOPe Domain Coordinates for d1m6bb3:

Click to download the PDB-style file with coordinates for d1m6bb3.
(The format of our PDB-style files is described here.)

Timeline for d1m6bb3: