Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) |
Family g.3.9.1: Growth factor receptor domain [57185] (8 proteins) |
Protein Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains [75668] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75669] (1 PDB entry) |
Domain d1m6ba3: 1m6b A:166-310 [74523] Other proteins in same PDB: d1m6ba1, d1m6ba2, d1m6bb1, d1m6bb2 |
PDB Entry: 1m6b (more details), 2.6 Å
SCOP Domain Sequences for d1m6ba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} pchevckgrcwgpgsedcqtltkticapqcnghcfgpnpnqcchdecaggcsgpqdtdcf acrhfndsgacvprcpqplvynkltfqlepnphtkyqyggvcvascphnfvvdqtscvra cppdkmevdknglkmcepcgglcpk
Timeline for d1m6ba3:
View in 3D Domains from other chains: (mouse over for more information) d1m6bb1, d1m6bb2, d1m6bb3, d1m6bb4 |