Lineage for d1m6ba3 (1m6b A:166-310)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3030969Family g.3.9.1: Growth factor receptor domain [57185] (11 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
  6. 3031013Protein Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains [75668] (1 species)
  7. 3031014Species Human (Homo sapiens) [TaxId:9606] [75669] (1 PDB entry)
  8. 3031015Domain d1m6ba3: 1m6b A:166-310 [74523]
    Other proteins in same PDB: d1m6ba1, d1m6ba2, d1m6bb1, d1m6bb2
    complexed with nag, so4

Details for d1m6ba3

PDB Entry: 1m6b (more details), 2.6 Å

PDB Description: structure of the her3 (erbb3) extracellular domain
PDB Compounds: (A:) Receptor protein-tyrosine kinase erbB-3

SCOPe Domain Sequences for d1m6ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
pchevckgrcwgpgsedcqtltkticapqcnghcfgpnpnqcchdecaggcsgpqdtdcf
acrhfndsgacvprcpqplvynkltfqlepnphtkyqyggvcvascphnfvvdqtscvra
cppdkmevdknglkmcepcgglcpk

SCOPe Domain Coordinates for d1m6ba3:

Click to download the PDB-style file with coordinates for d1m6ba3.
(The format of our PDB-style files is described here.)

Timeline for d1m6ba3: