Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
Superfamily c.10.2: L domain-like [52058] (8 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (4 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein Receptor protein-tyrosine kinase Erbb-3 extracellular domain [75145] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75146] (1 PDB entry) |
Domain d1m6ba2: 1m6b A:311-479 [74522] Other proteins in same PDB: d1m6ba3, d1m6ba4, d1m6bb3, d1m6bb4 |
PDB Entry: 1m6b (more details), 2.6 Å
SCOP Domain Sequences for d1m6ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m6ba2 c.10.2.5 (A:311-479) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens)} acegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipaldpeklnvfrt vreitgylniqswpphmhnfsvfsnlttiggrslynrgfsllimknlnvtslgfrslkei sagriyisanrqlcyhhslnwtkvlrgpteerldikhnrprrdcvaegk
Timeline for d1m6ba2:
View in 3D Domains from other chains: (mouse over for more information) d1m6bb1, d1m6bb2, d1m6bb3, d1m6bb4 |