Lineage for d1m6ba2 (1m6b A:311-479)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310356Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 310397Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 310441Family c.10.2.5: L domain [52071] (4 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 310457Protein Receptor protein-tyrosine kinase Erbb-3 extracellular domain [75145] (1 species)
  7. 310458Species Human (Homo sapiens) [TaxId:9606] [75146] (1 PDB entry)
  8. 310460Domain d1m6ba2: 1m6b A:311-479 [74522]
    Other proteins in same PDB: d1m6ba3, d1m6ba4, d1m6bb3, d1m6bb4

Details for d1m6ba2

PDB Entry: 1m6b (more details), 2.6 Å

PDB Description: structure of the her3 (erbb3) extracellular domain

SCOP Domain Sequences for d1m6ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m6ba2 c.10.2.5 (A:311-479) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens)}
acegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipaldpeklnvfrt
vreitgylniqswpphmhnfsvfsnlttiggrslynrgfsllimknlnvtslgfrslkei
sagriyisanrqlcyhhslnwtkvlrgpteerldikhnrprrdcvaegk

SCOP Domain Coordinates for d1m6ba2:

Click to download the PDB-style file with coordinates for d1m6ba2.
(The format of our PDB-style files is described here.)

Timeline for d1m6ba2: