Lineage for d1m62a_ (1m62 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636805Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 636806Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 636821Protein Silencer of death domains, Sodd (Bag4) [74699] (1 species)
  7. 636822Species Human (Homo sapiens) [TaxId:9606] [74700] (2 PDB entries)
  8. 636823Domain d1m62a_: 1m62 A: [74520]

Details for d1m62a_

PDB Entry: 1m62 (more details)

PDB Description: solution structure of the bag domain from bag4/sodd
PDB Compounds: (A:) BAG-family molecular chaperone regulator-4

SCOP Domain Sequences for d1m62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m62a_ a.7.7.1 (A:) Silencer of death domains, Sodd (Bag4) {Human (Homo sapiens) [TaxId: 9606]}
gspeftppsikkiihvlekvqyleqeveefvgkktdkaywlleemltkelleldsvetgg
qdsvrqarkeavckiqaileklekkgl

SCOP Domain Coordinates for d1m62a_:

Click to download the PDB-style file with coordinates for d1m62a_.
(The format of our PDB-style files is described here.)

Timeline for d1m62a_: